The domain within your query sequence starts at position 116 and ends at position 179; the E-value for the TRM13 domain shown below is 5.2e-19.
KQQASILGNIEKLKLLGPRRCFVEFGAGKGKLSHWVDIALKDAENVHFILVERVTTRFKV DGKH
TRM13 |
 |
|---|
| PFAM accession number: | PF05206 |
|---|---|
| Interpro abstract (IPR007871): | This entry consists of eukaryotic and bacterial proteins that specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signatures [ (PUBMED:17242307) ]. The alignment contains some conserved cysteines and histidines that might form a zinc binding site. |
| GO process: | tRNA processing (GO:0008033) |
| GO function: | methyltransferase activity (GO:0008168) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TRM13