The domain within your query sequence starts at position 58 and ends at position 117; the E-value for the TSC22 domain shown below is 3.2e-35.

MDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGS

TSC22

 TSC22
PFAM accession number:PF01166
Interpro abstract (IPR000580):

Several eukaryotic proteins are evolutionary related and are thought to be involved in transcriptional regulation. These proteins are highly similar in a region of about 50 residues that include a conserved leucine-zipper domain most probably involved in homo- or hetero-dimerisation. Proteins containing this signature include:

  • Vertebrate protein TSC-22 [ (PUBMED:9022669) ], a transcriptional regulator which seems to act on C-type natriuretic peptide (CNP) promoter.
  • Mammalian protein DIP (DSIP-immunoreactive peptide) [ (PUBMED:8982256) ], a protein whose function is not yet known.
  • Drosophila protein bunched [ (PUBMED:7555710) ] (gene bun) (also known as shortsighted), a probable transcription factor required for peripheral nervous system morphogenesis, eye development and oogenesis.
  • Caenorhabditis elegans hypothetical protein T18D3.7.

GO process:regulation of transcription, DNA-templated (GO:0006355)
GO function:DNA-binding transcription factor activity (GO:0003700)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TSC22