The domain within your query sequence starts at position 20 and ends at position 137; the E-value for the TSLP domain shown below is 1.1e-49.

YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCP
SLPDKTFARRTREALNDHCPGYPETERNDGTQEMAQEVQNICLNQTSQILRLWYSFMQ

TSLP

TSLP
PFAM accession number:PF15216
Interpro abstract (IPR029189):

Thymic stromal lymphopoietin (TSLP) is a cytokine that functions mainly on myeloid cells; it induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c(+) dendritic cells [ (PUBMED:11418668) ]. TSLP has proliferative effects on the myeloid cell line [ (PUBMED:11480573) ] and may initiate asthma or atopic dermatitis responses by directly activating mast cells [ (PUBMED:17242164) ].

GO function:cytokine activity (GO:0005125)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TSLP