The domain within your query sequence starts at position 728 and ends at position 763; the E-value for the TSP_3 domain shown below is 5.8e-12.

EDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQ

TSP_3

TSP_3
PFAM accession number:PF02412
Interpro abstract (IPR003367):

The thrombospondin repeat is a short aspartate rich repeat which binds to calcium ions. The repeat was initially identified in thrombospondin proteins that contained 7 of these repeats [ (PUBMED:2430973) ]. The repeat lacks defined secondary structure [ (PUBMED:15014436) ].

This entry represents the type 3 thrombospondin repeat found in proteins of the thrombospondin family and related repeats present in other types of proteins.

GO process:cell adhesion (GO:0007155)
GO function:calcium ion binding (GO:0005509)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TSP_3