The domain within your query sequence starts at position 885 and ends at position 920; the E-value for the TSP_3 domain shown below is 1.3e-11.
ADHDNDGKGDACDSDDDNDGVPDDRDNCRLVFNPDQ
TSP_3 |
---|
PFAM accession number: | PF02412 |
---|---|
Interpro abstract (IPR003367): | The thrombospondin repeat is a short aspartate rich repeat which binds to calcium ions. The repeat was initially identified in thrombospondin proteins that contained 7 of these repeats [ (PUBMED:2430973) ]. The repeat lacks defined secondary structure [ (PUBMED:15014436) ]. This entry represents the type 3 thrombospondin repeat found in proteins of the thrombospondin family and related repeats present in other types of proteins. |
GO process: | cell adhesion (GO:0007155) |
GO function: | calcium ion binding (GO:0005509) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TSP_3