The domain within your query sequence starts at position 128 and ends at position 281; the E-value for the TTD domain shown below is 8e-61.
LGLYKVNEYVDVRDNIFGAWFEAQVVQVQKRALSEDEPCSSSAVKTSEDDIMYHVKYDDY PEHGVDIVKAKNVRARARTVIPWENLEVGQVVMANYNVDYPRKRGFWYDVEICRKRQTRT ARELYGNIRLLNDSQLNNCRIMFVDEVLMIELPK
TTD |
![]() |
---|
PFAM accession number: | PF12148 |
---|---|
Interpro abstract (IPR021991): | TTD, tandem tudor domain within UHRF1 preferentially binds H3 histone tails trimethylated at Lys-9. It specifically recognises H3 tail peptides with the heterochromatin-associated modification state of trimethylated lysine 9 and unmodified lysine 4 (H3K4me0/K9me3) [ (PUBMED:14741369) (PUBMED:21489993) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TTD