The domain within your query sequence starts at position 645 and ends at position 940; the E-value for the TTL domain shown below is 2.2e-106.
FRSIREHQKLNHFPGSFQIGRKDRLWRNLSRMQSRFGKKEFSFFPQSFILPQDSKLLRKA WESSSRQKWIVKPPASARGIGIQVIHKWSQLPKRRPLLVQRYLHKPYLISGSKFDLRIYV YVTSYDPLRIYLFSDGLVRFASCKYSPSMKSLSNKFMHLTNYSVNKKNTEYQANADETAC QGHKWALKALWNYLSQKGINSDAIWEKIKDVVVKTIISSEPYVTNLLKLYVRRPYSCHEL FGFDIMLDENLKPWVLEVNISPSLHSNSPLDISIKGQMIRDLLNLAGFVLPNMEDI
TTL |
![]() |
---|
PFAM accession number: | PF03133 |
---|---|
Interpro abstract (IPR004344): | Tubulins and microtubules are subjected to several post-translational modifications of the carboxy-terminal end of most major forms of tubulins has been extensively analysed. This modification cycle involves a specific carboxypeptidase and the activity of the tubulin-tyrosine ligase (TTL) and the tubulin polyglutamylase (TTLL) [ (PUBMED:10685598) (PUBMED:19524510) ]. Tubulin-tyrosine ligase (TTL) catalyses the ATP-dependent post-translational addition of a tyrosine to the carboxy terminal end of detyrosinated alpha-tubulin. Tubulin polyglutamylase (such as TTLL10) can modify both tubulin and non-tubulin proteins, generating side chains of glycine on the gamma-carboxyl groups of specific glutamate residues of target proteins [ (PUBMED:19524510) ]. Tubulin polyglutamylation may be involved in the organisation of the neuronal microtubule network, in centriole stability, axoneme motility and mitosis [ (PUBMED:15890843) ]. |
GO process: | cellular protein modification process (GO:0006464) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TTL