The domain within your query sequence starts at position 15 and ends at position 103; the E-value for the T_cell_tran_alt domain shown below is 2.9e-39.
ATVLGALGTLGSDFLREWETQDMRVTLFKLLLLWLVLSLLGIQLAWGFYGNTVTGLYHRP GLGGQNGSTPDGSTHFSSWQQQKGLQRYR
T_cell_tran_alt |
 |
|---|
| PFAM accession number: | PF15128 |
|---|---|
| Interpro abstract (IPR016560): | This entry represents the T-cell leukemia translocation-altered gene protein. It may be required for cellular fusion during osteoclastogenesis [ (PUBMED:19560569) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry T_cell_tran_alt