The domain within your query sequence starts at position 50 and ends at position 134; the E-value for the Takusan domain shown below is 1.4e-30.
RQTSSPVPVISKKQFEKEEKKLIKEIQLTTEETNELRDRLIYVTEGSMNKRPYHRQNPLY EKLKLKEKEIMTFLHNLEMENMEAK
Takusan |
 |
|---|
| PFAM accession number: | PF04822 |
|---|---|
| Interpro abstract (IPR006907): | This domain is found in an number of proteins, including Disks large homologue 5 and members of the takusan gene family [ (PUBMED:17610818) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Takusan