The domain within your query sequence starts at position 1 and ends at position 146; the E-value for the TatD_DNase domain shown below is 2.9e-38.
XQLKLAVSLKKPLVIHCREADEDLLDIMRKFVPSDYKIHRHCFTGSYSVIEPLLKYFPNM SVGFTAVLTYSSAWEARDALRQIPLERIIVETDAPYFLPRQVPRSLCQYAHPGLALHTVR EIARVKEESLSHTLSVLRENTCRLYS
TatD_DNase |
---|
PFAM accession number: | PF01026 |
---|---|
Interpro abstract (IPR001130): | This entry represents the TatD family, which includes TatD and many putative deoxyribonucleases and metal-dependent hydrolases. The family is related to a large superfamily of metalloenzymes [ (PUBMED:9144792) ]. TatD has been shown to be a 3'-5' exonuclease that processes single-stranded DNA in DNA repair [ (PUBMED:10747959) (PUBMED:25114049) ]. In E. coli TatD is encoded by a operon that encodes Tat proteins, including TatA, TatB, and TatC, for protein transport via the Tat (Twin-Arginine Translocation) pathway. However, TatD is not involved in the protein export in the Tat pathway [ (PUBMED:10747959) ]. |
GO function: | hydrolase activity, acting on ester bonds (GO:0016788) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TatD_DNase