SMART: Pfam domain TatD

The domain within your query sequence starts at position 6 and ends at position 263; the E-value for the TatD_DNase domain shown below is 5e-57.

VDCHCHLSASDFDNDLDDVLEKARKANVMALVAVAEHAGEFERIMQLSERYNGFVLPCLG
VHPVQELSPEKPRSVTLKDLDVALPIIEKYKDRLLAIGEVGLDFTPRYAGTDEEKEEQRQ
VLIRQVQLAKRLNVPLNVHSRSAGRPTISLLREQGAKQVLLHAFDGRPSVAMEGARAGYY
FSIPPSIVRSGQQKLVKQLPLSSICLETDSPALGPEKLTRNEPCNISIAAEFIAQVKGIS
VEEVREVTTRNAFRLFPK

TatD_DNase

PFAM accession number:	PF01026
Interpro abstract (IPR001130):	This entry represents the TatD family, which includes TatD and many putative deoxyribonucleases and metal-dependent hydrolases. The family is related to a large superfamily of metalloenzymes [ (PUBMED:9144792) ]. TatD has been shown to be a 3'-5' exonuclease that processes single-stranded DNA in DNA repair [ (PUBMED:10747959) (PUBMED:25114049) ]. In E. coli TatD is encoded by a operon that encodes Tat proteins, including TatA, TatB, and TatC, for protein transport via the Tat (Twin-Arginine Translocation) pathway. However, TatD is not involved in the protein export in the Tat pathway [ (PUBMED:10747959) ].
GO function:	hydrolase activity, acting on ester bonds (GO:0016788)

PFAM accession number:

PF01026

Interpro abstract (IPR001130):

This entry represents the TatD family, which includes TatD and many putative deoxyribonucleases and metal-dependent hydrolases. The family is related to a large superfamily of metalloenzymes [ (PUBMED:9144792) ]. TatD has been shown to be a 3'-5' exonuclease that processes single-stranded DNA in DNA repair [ (PUBMED:10747959) (PUBMED:25114049) ].

In E. coli TatD is encoded by a operon that encodes Tat proteins, including TatA, TatB, and TatC, for protein transport via the Tat (Twin-Arginine Translocation) pathway. However, TatD is not involved in the protein export in the Tat pathway [ (PUBMED:10747959) ].

GO function:

hydrolase activity, acting on ester bonds (GO:0016788)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TatD_DNase