The domain within your query sequence starts at position 12 and ends at position 177; the E-value for the Ten_N domain shown below is 5.1e-30.

LSKVKHEMDLAYTSSSDESEDGRKPRQSFNSRETLHEYNQELRRNYNSQSRKRKDVEKST
QEIEFCETPPTLCSGYHTDMHSVSRHGYQLEMGSDVDTETEGAASPDHALRMWIRGMKSE
HSSCLSSRANSALSLTDTDHERKSDGENGFKFSPVCCDMEAPADSA

Ten_N

 Ten_N
PFAM accession number:PF06484
Interpro abstract (IPR009471):

Teneurins are a family of phylogenetically conserved transmembrane glycoproteins expressed during pattern formation and morphogenesis [ (PUBMED:11146505) ]. Originally discovered as ten-m and ten-a in Drosophila melanogaster the teneurin family is conserved from Caenorhabditis elegans (ten-1) to vertebrates, in which four paralogs exist (teneurin-1 to -4 or odz-1 to -4). Their distinct domain architecture is highly conserved between invertebrate and vertebrate teneurins, particularly in the extracellular part. The intracellular domains of Ten-a, Ten-m/Odz and C. elegans Ten-1 are significantly different, both in size and structure, from the comparable domains of vertebrate teneurins, but the extracellular domains of all of these proteins are remarkably similar.

The large C-terminal extracellular domain consists of eight EGF-like repeats a region of conserved cysteines and unique YD-repeats. The N-terminal intracellular domain of vertebrate teneurins contains two EF-hand-like calcium-binding motifs and two polyproline regions involved in protein-protein interactions, followed by a single-span transmembrane domain. The intracellular domain is linked to the cytoskeleton through its interaction with the adaptor protein CAP/ponsin and can be cleaved near (or possibly in) the transmembrane domain and transported to the nucleus [ (PUBMED:12361962) (PUBMED:10588872) ], giving teneurins the potential to act as transcription factors [ (PUBMED:12783990) (PUBMED:12783990) ]. There is considerable divergence between intracellular domains of invertebrate and vertebrate teneurins as well as between different invertebrate proteins [ (PUBMED:10341219) (PUBMED:12783990) (PUBMED:16406038) (PUBMED:17095284) (PUBMED:17502993) ].

This domain is found in the intracellular N-terminal region of the Teneurin family.

GO process:signal transduction (GO:0007165)
GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ten_N