The domain within your query sequence starts at position 52 and ends at position 325; the E-value for the Thiolase_N domain shown below is 4.6e-96.
MKNIVVVEGVRIPFLLSGTSYKDLMPHDLARAALSGLLHRTNIPKDVVDYIIFGTVIQEV KTSNVAREAALGAGFSDKTPAHTVTMACISSNQAMTTAVGLIASGQCDVVVAGGVELMSD VPIRHSRNMRKMMLDLNKAKTLGQRLSLLSKFRLNFLSPELPAVAEFSTNETMGHSADRL AAAFAVSRMEQDEYALRSHSLAKKAQDEGHLSDIVPFKVPGKDTVTKDNGIRPSSLEQMA KLKPAFIKPYGTVTAANSSFLTDGASAMLIMSED
Thiolase_N |
---|
PFAM accession number: | PF00108 |
---|---|
Interpro abstract (IPR020616): | Two different types of thiolase [ (PUBMED:1755959) (PUBMED:2191949) (PUBMED:1354266) ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase ( EC 2.3.1.9 ) and 3-ketoacyl-CoA thiolase ( EC 2.3.1.16 ). 3-ketoacyl-CoA thiolase (also called thiolase I) has a broad chain-length specificity for its substrates and is involved in degradative pathways such as fatty acid beta-oxidation. Acetoacetyl-CoA thiolase (also called thiolase II) is specific for the thiolysis of acetoacetyl-CoA and involved in biosynthetic pathways such as poly beta-hydroxybutyrate synthesis or steroid biogenesis. In eukaryotes, there are two forms of 3-ketoacyl-CoA thiolase: one located in the mitochondrion and the other in peroxisomes. There are two conserved cysteine residues important for thiolase activity. The first located in the N-terminal section of the enzymes is involved in the formation of an acyl-enzyme intermediate; the second located at the C-terminal extremity is the active site base involved in deprotonation in the condensation reaction. Mammalian nonspecific lipid-transfer protein (nsL-TP) (also known as sterol carrier protein 2) is a protein which seems to exist in two different forms: a 14 Kd protein (SCP-2) and a larger 58 Kd protein (SCP-x). The former is found in the cytoplasm or the mitochondria and is involved in lipid transport; the latter is found in peroxisomes. The C-terminal part of SCP-x is identical to SCP-2 while the N-terminal portion is evolutionary related to thiolases [ (PUBMED:1755959) ]. |
GO function: | transferase activity, transferring acyl groups other than amino-acyl groups (GO:0016747) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Thiolase_N