SMART: Pfam domain Thioredox

The domain within your query sequence starts at position 66 and ends at position 228; the E-value for the Thioredox_DsbH domain shown below is 2.9e-75.

VNRLINEKSPYLLQHAYNPVDWYPWGQEAFDKAKKENKPIFLSVGYSTCHWCHMMEEESF
QNEEIGRLLNENFICVMVDREERPDVDKVYMTFVQATSSGGGWPMNVWLTPGLQPFVGGT
YFPPEDGLTRVGFRTVLMRICDQWKLNKNTLLENSQRVTTALL

Thioredox_DsbH

PFAM accession number:	PF03190
Interpro abstract (IPR004879):	Members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif. The human/rat protein, called SSP411, is specifically expressed in the testis in an age-dependent manner. The SSP411 mRNA is increased during spermiogenesis and is localized in round and elongated spermatids, suggesting a function in fertility regulation [ (PUBMED:15223837) ].

PFAM accession number:

PF03190

Interpro abstract (IPR004879):

Members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif. The human/rat protein, called SSP411, is specifically expressed in the testis in an age-dependent manner. The SSP411 mRNA is increased during spermiogenesis and is localized in round and elongated spermatids, suggesting a function in fertility regulation [ (PUBMED:15223837) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Thioredox_DsbH