SMART: Pfam domain Thioredoxin

The domain within your query sequence starts at position 38 and ends at position 125; the E-value for the Thioredoxin_2 domain shown below is 4.8e-9.

VVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAV
PTVLAIKNGDVVDKFVGIKDEDQLEAFL

Thioredoxin_2

PFAM accession number:	PF13098
Interpro abstract (IPR012336):	Several biological processes regulate the activity of target proteins through changes in the redox state of thiol groups (S2 to SH2), where a hydrogen donor is linked to an intermediary disulphide protein. Such processes include the ferredoxin/thioredoxin system, the NADP/thioredoxin system, and the glutathione/glutaredoxin system [ (PUBMED:15862094) ]. Several of these disulphide proteins share a common structure, consisting of a three-layer alpha/beta/alpha core.

PFAM accession number:

PF13098

Interpro abstract (IPR012336):

Several biological processes regulate the activity of target proteins through changes in the redox state of thiol groups (S2 to SH2), where a hydrogen donor is linked to an intermediary disulphide protein. Such processes include the ferredoxin/thioredoxin system, the NADP/thioredoxin system, and the glutathione/glutaredoxin system [ (PUBMED:15862094) ]. Several of these disulphide proteins share a common structure, consisting of a three-layer alpha/beta/alpha core.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Thioredoxin_2