SMART: Pfam domain Tis11B

The domain within your query sequence starts at position 1 and ends at position 107; the E-value for the Tis11B_N domain shown below is 3.2e-50.

MTTTLVSATIFDLSEVLCKGNKMLNYSTPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSS
KFHQNQLLSSLKGEPAPSLSSRDSRFRDRSFSEGGERLLPTQKQPGS

Tis11B_N

PFAM accession number:	PF04553
Interpro abstract (IPR007635):	All proteins of containing this domain also contain a tandem repeat of CCCH zinc fingers ( IPR000571 ). Tis11B, Tis11D and their homologues are thought to be regulatory proteins involved in the response to growth factors [ (PUBMED:1695727) ]. Tis11B ( Q07352 ) is thought to be involved in calcium signalling-induced apoptosis in B cells [ (PUBMED:8898945) ]. The function of this N-terminal domain is unknown.

PFAM accession number:

PF04553

Interpro abstract (IPR007635):

All proteins of containing this domain also contain a tandem repeat of CCCH zinc fingers ( IPR000571 ). Tis11B, Tis11D and their homologues are thought to be regulatory proteins involved in the response to growth factors [ (PUBMED:1695727) ]. Tis11B ( Q07352 ) is thought to be involved in calcium signalling-induced apoptosis in B cells [ (PUBMED:8898945) ]. The function of this N-terminal domain is unknown.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tis11B_N