The domain within your query sequence starts at position 1 and ends at position 197; the E-value for the Tmemb_55A domain shown below is 1.9e-82.
MAADGERSPLLSEAGDGGAGGNGLAGPGGSATGPGGGLTPSAPPYGAGKHAPPQAFPPFP EGHPAVLPGEDPPPYSPLTSPDSGSAPMITCRVCQSPINVEGKMHQHVVKCGVCNEATPI KNAPPGKKYVRCPCNCLLICKVTSQRIACPRPYCKRIINLGPVHPGPLSPEPQPMGVRVI CGHCKNTFLVRRDIGKP
Tmemb_55A |
---|
PFAM accession number: | PF09788 |
---|---|
Interpro abstract (IPR019178): | Phosphatidylinositol-4,5-bisphosphate 4-phosphatases type I and type II, also known as transmembrane proteins 55B and 55A, are two metazoan enzymes that catalyse the hydrolysis of PtdIns-4,5-P(2) to phosphatidylinositol-5-phosphate (PtdIns-5-P) [ (PUBMED:16365287) ]. |
GO process: | phosphatidylinositol dephosphorylation (GO:0046856) |
GO function: | phosphatidylinositol-4,5-bisphosphate 4-phosphatase activity (GO:0034597) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tmemb_55A