The domain within your query sequence starts at position 1 and ends at position 152; the E-value for the Tmp39 domain shown below is 4.9e-44.
XLAAFITVMLARRLVWALISEATKAGAASTVHYTALILARLVLLTLCGWVLCWTLVNLFR SHSVLNLLFLGYPFGVYVPLYCFHQDSRAHLLLTDYVVQHQAVEEAASNVGSLARSKDFL SLLLESLKEQFNNATPIPTHSCPLSPDLIHLG
Tmp39 |
---|
PFAM accession number: | PF10271 |
---|---|
Interpro abstract (IPR019397): | This is a family of putative, eukaryote, transmembrane proteins but the function is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tmp39