The domain within your query sequence starts at position 138 and ends at position 216; the E-value for the Tom37_C domain shown below is 5.4e-24.
AFMSLLEEKLLPVLIHTFWIDAKNYVEVTRKWYAEAMPFPLNFFLPGRMQRQYMERLQLL CGEHKSENEEELEKELYQE
Tom37_C |
---|
PFAM accession number: | PF11801 |
---|---|
Interpro abstract (IPR031317): | The TOM37 protein is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space. In conjunction with TOM70 it guides peptides without an MTS into TOM40, the protein that forms the passage through the outer membrane [ (PUBMED:16890951) ]. It has homology with Metaxin-1, also part of the outer mitochondrial membrane beta-barrel protein transport complex [ (PUBMED:17981999) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tom37_C