SMART: Pfam domain Transcrip

The domain within your query sequence starts at position 128 and ends at position 276; the E-value for the Transcrip_act domain shown below is 9.3e-11.

KPDCKVEKKKMELQEKSRWEVLQQEQRLMEEKNKRKKALLAQAIAERSKKTQAETIKLKR
IQKELQALDDMVSADIGILRNRIDQASLEYSYARKRFDRAEAEYITAKLDLQRKTETKEQ
LTEHLCTIIQQNELRKAKKLEELMQQLDV

Transcrip_act

PFAM accession number:	PF04949
Interpro abstract (IPR007033):	This entry represents RAB6-interacting golgin, including SCYL1BP1 (also known as GORAB) from humans. SCYL1BP1 localises to the Golgi apparatus and interacts with Rab6 [ (PUBMED:18997784) (PUBMED:26000619) ]. Therefore, SCYL1BP1 is identified as a golgin, a protein that tether vesicles to the Golgi apparatus. This entry also includes plant proteins, such as TaSRG ( F4MH09 ) from wheat. TaSRG plays a role in stress response in plants [ (PUBMED:21457711) ].

PFAM accession number:

PF04949

Interpro abstract (IPR007033):

This entry represents RAB6-interacting golgin, including SCYL1BP1 (also known as GORAB) from humans. SCYL1BP1 localises to the Golgi apparatus and interacts with Rab6 [ (PUBMED:18997784) (PUBMED:26000619) ]. Therefore, SCYL1BP1 is identified as a golgin, a protein that tether vesicles to the Golgi apparatus.

This entry also includes plant proteins, such as TaSRG ( F4MH09 ) from wheat. TaSRG plays a role in stress response in plants [ (PUBMED:21457711) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Transcrip_act