The domain within your query sequence starts at position 11 and ends at position 127; the E-value for the Transglut_N domain shown below is 1.4e-31.

EVALTDLQSSQNNVRHHTEEISVDRLVVRRGQAFSITLYFKNRGFQPGMDSIMFVAETGP
LPDLAKGTRAVFSFTGSGGPSPWIASLEANRANSLEVSLCAPPIAAVGRYLLKIRID

Transglut_N

Transglut_N
PFAM accession number:PF00868
Interpro abstract (IPR001102):

Synonym(s): Protein-glutamine gamma-glutamyltransferase, Fibrinoligase, TGase

Protein-glutamine gamma-glutamyltransferases ( EC 2.3.2.13 ) (TGase) are calcium-dependent enzymes that catalyse the cross-linking of proteins by promoting the formation of isopeptide bonds between the gamma-carboxyl group of a glutamine in one polypeptide chain and the epsilon-amino group of a lysine in a second polypeptide chain. TGases also catalyse the conjugation of polyamines to proteins [ (PUBMED:1683845) (PUBMED:1974250) ].

Transglutaminases are widely distributed in various organs, tissues and body fluids. The best known transglutaminase is blood coagulation factor XIII, a plasma tetrameric protein composed of two catalytic A subunits and two non-catalytic B subunits. Factor XIII is responsible for cross-linking fibrin chains, thus stabilising the fibrin clot.

There are commonly three domains: N-terminal, middle ( IPR013808 ) and C-terminal ( IPR008958 ). This entry represents the N-terminal domain found in transglutaminases.

GO process:peptide cross-linking (GO:0018149)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Transglut_N