SMART: Pfam domain Transposase

The domain within your query sequence starts at position 175 and ends at position 295; the E-value for the Transposase_22 domain shown below is 4e-21.

AREASCQSEENRLKAPKESPPEGGAGATLRLAADFSAATLDVGRQWSQVFRLLKEKELEP
ELQCSVKLAFKCDGEANVFSDLHSLRQFTSRKPFLRELLKDVFPQNEGGRRNELRERLGK
T

Transposase_22

PFAM accession number:	PF02994
Interpro abstract (IPR043636):	This domain represents a conserved component in the protein ORF1 of the long interspersed nuclear element 1 (LINE-1 or L1) retrotransposon. This domain is designated RRM, which stands for RNA recognition motif, and is involved in RNA binding. Cooperation between this RRM domain and the C-terminal domain is required to achieve this, despite the fact that these two domains do not contact each other [ (PUBMED:21822284) (PUBMED:19139409) ].

PFAM accession number:

PF02994

Interpro abstract (IPR043636):

This domain represents a conserved component in the protein ORF1 of the long interspersed nuclear element 1 (LINE-1 or L1) retrotransposon. This domain is designated RRM, which stands for RNA recognition motif, and is involved in RNA binding. Cooperation between this RRM domain and the C-terminal domain is required to achieve this, despite the fact that these two domains do not contact each other [ (PUBMED:21822284) (PUBMED:19139409) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Transposase_22