SMART: Pfam domain TruB

The domain within your query sequence starts at position 84 and ends at position 187; the E-value for the TruB_N domain shown below is 3.2e-16.

PAFTNLKIGVGHRLDVQASGVLVLAVGHGRSLLTDMYDAHLTKDYTVRGLLGKATDNFCE
DGRLIEKTTYDHVTRERLDRILAVIQGSHQKALVIGAVYARDAA

TruB_N

PFAM accession number:	PF01509
Interpro abstract (IPR002501):	TruB is responsible for the pseudouridine residue present in the T loops of virtually all tRNAs. TruB recognises the preformed 3-D structure of the T loop primarily through shape complementarity. It accesses its substrate uridyl residue by flipping out the nucleotide and disrupts the tertiary structure of tRNA [ (PUBMED:11779468) ]. Pseudouridine synthases catalyse the isomerisation of uridine to pseudouridine (Psi) in a variety of RNA molecules, and may function as RNA chaperones. Pseudouridine is the most abundant modified nucleotide found in all cellular RNAs. There are four distinct families of pseudouridine synthases that share no global sequence similarity, but which do share the same fold of their catalytic domain(s) and uracil-binding site and are descended from a common molecular ancestor. The catalytic domain consists of two subdomains, each of which has an alpha+beta structure that has some similarity to the ferredoxin-like fold (note: some pseudouridine synthases contain additional domains). The active site is the most conserved structural region of the superfamily and is located between the two homologous domains. These families are [ (PUBMED:10529181) (PUBMED:19664587) ]: Pseudouridine synthase I, TruA. Pseudouridine synthase II, TruB, which contains and additional C-terminal PUA domain. Pseudouridine synthase RsuA. RluB, RluE and RluF are also part of this family. Pseudouridine synthase RluA. RluC and RluD belong to this family. Pseudouridine synthase TruD, which has a natural circular permutation in the catalytic domain, as well as an insertion of a family-specific alpha+beta subdomain. This entry represents an N-terminal domain found in pseudouridine synthase TruB, as well as Cbf5p that modifies rRNA [ (PUBMED:9472021) ].
GO process:	RNA processing (GO:0006396)

PFAM accession number:

PF01509

Interpro abstract (IPR002501):

TruB is responsible for the pseudouridine residue present in the T loops of virtually all tRNAs. TruB recognises the preformed 3-D structure of the T loop primarily through shape complementarity. It accesses its substrate uridyl residue by flipping out the nucleotide and disrupts the tertiary structure of tRNA [ (PUBMED:11779468) ].

Pseudouridine synthases catalyse the isomerisation of uridine to pseudouridine (Psi) in a variety of RNA molecules, and may function as RNA chaperones. Pseudouridine is the most abundant modified nucleotide found in all cellular RNAs. There are four distinct families of pseudouridine synthases that share no global sequence similarity, but which do share the same fold of their catalytic domain(s) and uracil-binding site and are descended from a common molecular ancestor. The catalytic domain consists of two subdomains, each of which has an alpha+beta structure that has some similarity to the ferredoxin-like fold (note: some pseudouridine synthases contain additional domains). The active site is the most conserved structural region of the superfamily and is located between the two homologous domains. These families are [ (PUBMED:10529181) (PUBMED:19664587) ]:

Pseudouridine synthase I, TruA.
Pseudouridine synthase II, TruB, which contains and additional C-terminal PUA domain.
Pseudouridine synthase RsuA. RluB, RluE and RluF are also part of this family.
Pseudouridine synthase RluA. RluC and RluD belong to this family.
Pseudouridine synthase TruD, which has a natural circular permutation in the catalytic domain, as well as an insertion of a family-specific alpha+beta subdomain.

This entry represents an N-terminal domain found in pseudouridine synthase TruB, as well as Cbf5p that modifies rRNA [ (PUBMED:9472021) ].

GO process:

RNA processing (GO:0006396)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TruB_N