The domain within your query sequence starts at position 85 and ends at position 221; the E-value for the Tsg domain shown below is 3.6e-49.

PPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQLHH
QNVSVPSNNVHAPFPSDKERMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIG
PECIDYGSKTVKCMNCM

Tsg

Tsg
PFAM accession number:PF04668
Interpro abstract (IPR006761):

Tsg was identified in Drosophila melanogaster as being required to specify the dorsal-most structures in the embryo, for example the amnioserosa. Biochemical experiments have revealed three key properties of Tsg:

  • it can synergistically inhibit Dpp/BMP action in both D. melanogaster and vertebrates by forming a tripartite complete between itself, SOG/chordin and a BMP ligand;
  • Tsg seems to enhance the Tld/BMP-1-mediated cleavage rate of SOG/chordin and may change the preference of site utilisation;
  • Tsg can promote the dissociation of chordin cysteine-rich-containing fragments from the ligand to inhibit BMP signalling [ (PUBMED:7958834) (PUBMED:11260716) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tsg