The domain within your query sequence starts at position 1027 and ends at position 1058; the E-value for the Tubulin-binding domain shown below is 4.4e-15.
VKIESQKLNFKEKAQAKVGSLDNVGHLPAGGA
Tubulin-binding |
![]() |
---|
PFAM accession number: | PF00418 |
---|---|
Interpro abstract (IPR001084): | Microtubules consist of tubulins as well as a group of additional proteins collectively known as the Microtubule Associated Proteins (MAP). MAP's have been classified into two classes: high molecular weight MAP's and Tau protein. The Tau proteins promote microtubule assembly and stabilise microtubules. The C-terminal region of these proteins contains three or four tandem repeats of about thirty amino acid residues which is implicated in tubulin binding and which seem to have a stiffening effect on microtubules. |
GO function: | tubulin binding (GO:0015631) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tubulin-binding