The domain within your query sequence starts at position 26 and ends at position 103; the E-value for the Tweety domain shown below is 1.3e-23.
LRPVPSGFAPRDQEYQQALLLVAALAGLGLGLSLIFIAVYLIRFCCCRPPEPHGAKSPPP GGGCVTWSCIAALLVGWC
Tweety |
---|
PFAM accession number: | PF04906 |
---|---|
Interpro abstract (IPR006990): | The protein product of the Drosophila tweety (tty) gene is thought to form a trans-membrane protein with five membrane-spanning regions and a cytoplasmic C terminus. Tweety has been suggested as a candidate for a large conductance chloride channel, both in vertebrate and insect cells. Three human homologs have been identified and designated TTYH1-3. TTYH2 has been associated with the progression of cancer, and Drosophila melanogaster tweety has been assumed to play a role in development. TTYH2, and TTYH3 bind to and are ubiquinated by Nedd4-2, a HECT type E3 ubiquitin ligase, which most likely plays a role in controlling the cellular levels of tweety family proteins [ (PUBMED:16219661) (PUBMED:18577513) (PUBMED:18260827) (PUBMED:17952139) (PUBMED:17116230) (PUBMED:15010458) (PUBMED:11597145) (PUBMED:10950931) ]. |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tweety