The domain within your query sequence starts at position 26 and ends at position 103; the E-value for the Tweety domain shown below is 1.3e-23.

LRPVPSGFAPRDQEYQQALLLVAALAGLGLGLSLIFIAVYLIRFCCCRPPEPHGAKSPPP
GGGCVTWSCIAALLVGWC

Tweety

Tweety
PFAM accession number:PF04906
Interpro abstract (IPR006990):

The protein product of the Drosophila tweety (tty) gene is thought to form a trans-membrane protein with five membrane-spanning regions and a cytoplasmic C terminus. Tweety has been suggested as a candidate for a large conductance chloride channel, both in vertebrate and insect cells. Three human homologs have been identified and designated TTYH1-3. TTYH2 has been associated with the progression of cancer, and Drosophila melanogaster tweety has been assumed to play a role in development. TTYH2, and TTYH3 bind to and are ubiquinated by Nedd4-2, a HECT type E3 ubiquitin ligase, which most likely plays a role in controlling the cellular levels of tweety family proteins [ (PUBMED:16219661) (PUBMED:18577513) (PUBMED:18260827) (PUBMED:17952139) (PUBMED:17116230) (PUBMED:15010458) (PUBMED:11597145) (PUBMED:10950931) ].

GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Tweety