The domain within your query sequence starts at position 1210 and ends at position 1343; the E-value for the U5_2-snRNA_bdg domain shown below is 1.1e-77.
KDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIG LMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLS MGHVLIPQSDLRWS
U5_2-snRNA_bdg |
![]() |
---|
PFAM accession number: | PF10597 |
---|---|
Interpro abstract (IPR019581): | The essential spliceosomal protein Prp8 interacts with U5 and U6 snRNAs and with specific pre-mRNA sequences that participate in catalysis [ (PUBMED:16431982) ]. This close association with crucial RNA sequences, together with extensive genetic evidence, suggests that Prp8 could directly affect the function of the catalytic core, perhaps acting as a splicing cofactor [ (PUBMED:16431982) ]. |
GO function: | U5 snRNA binding (GO:0030623) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry U5_2-snRNA_bdg