SMART: Pfam domain U6-snRNA

The domain within your query sequence starts at position 1442 and ends at position 1600; the E-value for the U6-snRNA_bdg domain shown below is 4.2e-97.

FKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGL
FWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIF
MHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQE

U6-snRNA_bdg

PFAM accession number:	PF10596
Interpro abstract (IPR019580):	This entry represents the interacting site for U6-snRNA, which is part of U4/U6. U5 tri-snRNPs complex of the spliceosome is a prime candidate for the role of cofactor in the spliceosome's RNA core. The essential spliceosomal protein Prp8 interacts with U5 and U6 snRNAs and with specific pre-mRNA sequences that participate in catalysis. This close association with crucial RNA sequences, together with extensive genetic evidence, suggests that Prp8 could directly affect the function of the catalytic core, perhaps acting as a splicing cofactor [ (PUBMED:16431982) ].
GO function:	U6 snRNA binding (GO:0017070)

PFAM accession number:

PF10596

Interpro abstract (IPR019580):

This entry represents the interacting site for U6-snRNA, which is part of U4/U6.

U5 tri-snRNPs complex of the spliceosome is a prime candidate for the role of cofactor in the spliceosome's RNA core. The essential spliceosomal protein Prp8 interacts with U5 and U6 snRNAs and with specific pre-mRNA sequences that participate in catalysis. This close association with crucial RNA sequences, together with extensive genetic evidence, suggests that Prp8 could directly affect the function of the catalytic core, perhaps acting as a splicing cofactor [ (PUBMED:16431982) ].

GO function:

U6 snRNA binding (GO:0017070)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry U6-snRNA_bdg