The domain within your query sequence starts at position 46 and ends at position 153; the E-value for the UAA domain shown below is 4.5e-30.
DIHLCLNFGFHPVCDQCYVCQDLVDRTRTWLYAACSVSYVGAMVSSNSALQFVNYPTQVL GKSCKPIPVMLLGVTLLKKKYPLAKYLCVLLIVAGVALFMYKPKKVVG
UAA |
---|
PFAM accession number: | PF08449 |
---|---|
Interpro abstract (IPR013657): | This family includes transporters with a specificity for UDP-N-acetylglucosamine [ (PUBMED:11432728) ]. |
GO process: | transmembrane transport (GO:0055085) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UAA