The domain within your query sequence starts at position 28 and ends at position 132; the E-value for the UBD domain shown below is 4e-42.
RNQPLKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHE LAQAIIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEE
UBD |
 |
|---|
| PFAM accession number: | PF16455 |
|---|---|
| Interpro abstract (IPR032752): | This domain can be found in the N terminus of DC-UbP/UBTD2. It has a novel structural fold and acts as a Ub-binding domain (UBD) but with low affinity [ (PUBMED:20440844) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UBD