SMART: Pfam domain ULD

The domain within your query sequence starts at position 58 and ends at position 156; the E-value for the ULD domain shown below is 1.7e-39.

LMIPVFCVVEQLDGSLEYDNREEHAEFVLVRKDVLFSQLVETALLALGYSHSSAAQAQGI
IKLGRWNPLPLSYVTDAPDATVADMLQDVYHVVTLKIQL

ULD

PFAM accession number:	PF16534
Interpro abstract (IPR032392):	This entry represents the N-terminal oligomerisation domain, also known as ULD domain, of the SATB (special AT-rich sequence-binding) protein. SATBs are global chromatin organisers and regulators of gene expression that are essential for T-cell development, breast cancer tumour growth and metastasis. SATBs assemble into a tetramer via the ULD (ubiquitin-like) domain, and the tetramerisation of SATBs are essential for recognising specific DNA sequences (such as multiple AT-rich DNA fragments). Thus, SATBs may regulate gene expression directly by binding to various promoters and upstream regions and thereby influencing promoter activity [ (PUBMED:22241778) ].

PFAM accession number:

PF16534

Interpro abstract (IPR032392):

This entry represents the N-terminal oligomerisation domain, also known as ULD domain, of the SATB (special AT-rich sequence-binding) protein. SATBs are global chromatin organisers and regulators of gene expression that are essential for T-cell development, breast cancer tumour growth and metastasis. SATBs assemble into a tetramer via the ULD (ubiquitin-like) domain, and the tetramerisation of SATBs are essential for recognising specific DNA sequences (such as multiple AT-rich DNA fragments). Thus, SATBs may regulate gene expression directly by binding to various promoters and upstream regions and thereby influencing promoter activity [ (PUBMED:22241778) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ULD