SMART: Pfam domain UNC-50

The domain within your query sequence starts at position 28 and ends at position 170; the E-value for the UNC-50 domain shown below is 9.2e-59.

GAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQTKDQWARDDPAFLVL
LSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFIDCVGVGLLISTLMWFVSNKYLVKRQSR
DYDVEWGYAFDVHLNAFYPLLVI

UNC-50

PFAM accession number:	PF05216
Interpro abstract (IPR007881):	This family contains several eukaryotic transmembrane proteins which are related to the Caenorhabditis elegans protein UNC-50 Q10045 . A mammalian homologue, UNCL is a novel inner nuclear membrane protein that associates with RNA and is involved in the cell-surface expression of neuronal nicotinic receptors. UNCL plays a broader role because UNCL homologues are present in two yeast and a plant species, none of which express nicotinic receptors and it is also found in tissues that lack nicotinic receptors.

PFAM accession number:

PF05216

Interpro abstract (IPR007881):

This family contains several eukaryotic transmembrane proteins which are related to the Caenorhabditis elegans protein UNC-50 Q10045 . A mammalian homologue, UNCL is a novel inner nuclear membrane protein that associates with RNA and is involved in the cell-surface expression of neuronal nicotinic receptors. UNCL plays a broader role because UNCL homologues are present in two yeast and a plant species, none of which express nicotinic receptors and it is also found in tissues that lack nicotinic receptors.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UNC-50