The domain within your query sequence starts at position 135 and ends at position 214; the E-value for the UNC-93 domain shown below is 5.1e-9.
GINVTPIAALLYTPVLIRFFGTKWMMFLAVGIYALFVSTNYWERYYTLVPSAVALGMAIV PLWASMGNYITRMSQKYYEY
UNC-93 |
 |
|---|
| PFAM accession number: | PF05978 |
|---|---|
| Interpro abstract (IPR010291): | The proteins in this family are represented by UNC-93 from Caenorhabditis elegans. UNC-93 colocalizes with SUP-10 and SUP-9 within muscle cells. Genetic studies suggest that these three proteins forms complex that coordinates muscle contraction. The function of UNC-93 is not known but is most likely an ion channel regulatory protein [ (PUBMED:14534247) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UNC-93