The domain within your query sequence starts at position 3 and ends at position 201; the E-value for the UNC119_bdg domain shown below is 8.7e-116.
VDINGDSRSTLTTLPLPVAEGSSPGKAEAEKPRCSSTPCSPMRRTVSGYQILHMDSNYLV GFTTGEELLKLAQKCTGGEDSKGEAMPALRAKQLDTGLARSSRLYKTRSRYYQPYEIPAV NGRRRRRMPSSGDKCTKPLPYEPYKALHGPLPLCLLKGKRAHSKSLDYLNLDKMNIKEPA DTEVLQYQLQHLTLRGDRV
UNC119_bdg |
---|
PFAM accession number: | PF15435 |
---|---|
Interpro abstract (IPR029219): | UNC119-binding protein family include human Macrophage immunometabolism regulator (also known as C5orf30) and its homologues from eukaryotes. C5orf30 may play a role in trafficking of proteins via its interaction with UNC119 and UNC119B cargo adapters. It may also play a role in ciliary membrane localisation [ (PUBMED:22085962) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UNC119_bdg