The domain within your query sequence starts at position 8 and ends at position 148; the E-value for the UPF0054 domain shown below is 7.6e-29.

LQRVVPIRRVPLRRKMDLVRSILGVKKFDLGIICVDNKTIQNINRIYRNKNVPTDVLSFS
FHENLKAGEFPQPHSPDDYNLGDIFLGVEYILQHCRESEDYCDVLTVTATHGLCHLLGFT
HSSKAEWQKMYNQEKLVLEEL

UPF0054

UPF0054
PFAM accession number:PF02130
Interpro abstract (IPR002036):

YbeY is a single strand-specific metallo-endoribonuclease involved in late-stage 70S ribosome quality control and in maturation of the 3' terminus of the 16S rRNA. It acts together with the RNase R to eliminate defective 70S ribosomes, but not properly matured 70S ribosomes or individual subunits, by a process mediated specifically by the 30S ribosomal subunit. It is involved in the processing of 16S, 23S and 5S rRNAs, with a particularly strong effect on maturation at both the 5'-and 3'-ends of 16S rRNA as well as maturation of the 5'-end of 23S and 5S rRNAs [ (PUBMED:20639334) (PUBMED:20807199) (PUBMED:23273979) (PUBMED:16511207) ].

The crystal structure of the protein from the hyperthermophilic bacteria Aquifex aeolicus has been determined. The overall fold consists of one central alpha-helix surrounded by a four-stranded beta-sheet and four other alpha-helices. Structure-based homology analysis reveals a good resemblance to the metal-dependent proteinases such as collagenases and gelatinases. However, experimental tests for collagenase and gelatinase-type function show no detectable activity under standard assay conditions [ (PUBMED:12832766) ].

GO process:rRNA processing (GO:0006364)
GO function:metalloendopeptidase activity (GO:0004222)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0054