The domain within your query sequence starts at position 41 and ends at position 209; the E-value for the UPF0160 domain shown below is 1.7e-76.
RIGTHNGTFHCDEALACALLRLLPEYANAEIVRTRDPEKLASCDIVVDVGGEYNPQSHRY DHHQRTFTETMSSLCPGKPWQTKLSSAGLVYLHFGRKLLAQLLGTSEEDSVVDTIYDKMY ENFVEEVDAVDNGISQWAEGEPRYAMTTTLSARVARLNPTWNQPNQDTE
UPF0160 |
---|
PFAM accession number: | PF03690 |
---|---|
Interpro abstract (IPR003226): | The function of this domain is not known, but it is found in several uncharacterised proteins and a probable metal dependent protein hydrolase. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0160