SMART: Pfam domain UPF0515

The domain within your query sequence starts at position 16 and ends at position 272; the E-value for the UPF0515 domain shown below is 1.3e-127.

REKFHGKVSPKKAGALMRKFGSDHTGVGRSIVYGVKQKDGQELSNDLDAQDPPEDMKQDQ
DIQAVATSLLPLTQANLRMFQRAQDDLIPAVDRQFACSSCDHVWWRRVPQRKEVSRCRKC
RKRYEPVPLDKMWGLAEFHCPKCRHNFRGWAQMGSPSPCYGCGFPVYPTRILPPRWDRDL
DRRSTHTHSCSAADCYNRREPHVPGTSCAHPKSRKQNHLPKVLHPSNPHISSGSTVATCL
SQGGLVDDLDHLILEDL

UPF0515

PFAM accession number:	PF15135
Interpro abstract (IPR026795):	This family describes shiftless antiviral inhibitor of ribosomal frameshifting protein (SHFL). SHFL has been shown to inhibit programmed -1 ribosomal frameshifting (-1PRF) in a variety of mRNAs from viruses (for example HIV1 GAG-POL) as well as cellular genes [ (PUBMED:30682371) ]. SHFL is also known as repressor of yield of DENV (RyDEN), and has been identified as a interferon-stimulated cellular inhibitor against Dengue Virus (DENV) and other viruses replication [ (PUBMED:26735137) ]. It is likely to interfere with the translation of DENV via interaction with viral RNA and cellular mRNA-binding proteins.

PFAM accession number:

PF15135

Interpro abstract (IPR026795):

This family describes shiftless antiviral inhibitor of ribosomal frameshifting protein (SHFL). SHFL has been shown to inhibit programmed -1 ribosomal frameshifting (-1PRF) in a variety of mRNAs from viruses (for example HIV1 GAG-POL) as well as cellular genes [ (PUBMED:30682371) ].

SHFL is also known as repressor of yield of DENV (RyDEN), and has been identified as a interferon-stimulated cellular inhibitor against Dengue Virus (DENV) and other viruses replication [ (PUBMED:26735137) ]. It is likely to interfere with the translation of DENV via interaction with viral RNA and cellular mRNA-binding proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0515