The domain within your query sequence starts at position 398 and ends at position 451; the E-value for the UPF0564 domain shown below is 5.8e-8.
PGRSPRRKSPGRSSNPKPRPHECSPPMPTASSRGREQAIRRSEKARMREYWQEL
UPF0564 |
---|
PFAM accession number: | PF10595 |
---|---|
Interpro abstract (IPR019579): | This entry represents proteins with no known function. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0564