The domain within your query sequence starts at position 2 and ends at position 48; the E-value for the UPF0731 domain shown below is 3.6e-21.

PFRFGTQPRRFPVEGGDSSIELESGLSSSASCTGKETSPNRWTFCQL

UPF0731

UPF0731
PFAM accession number:PF14982
Interpro abstract (IPR028025):

The FAM229 (also known as UPF0731) family of uncharacterised proteins is found in mammals.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0731