The domain within your query sequence starts at position 2 and ends at position 80; the E-value for the UPF0731 domain shown below is 4.8e-49.
PFRFGTQPRRFPVEGGDSSIELESGLSSSASCTGKETSPNRQLRRCPGSHCLTITDVPIT VYATMRKPPAQSSKEMHPK
UPF0731 |
---|
PFAM accession number: | PF14982 |
---|---|
Interpro abstract (IPR028025): | The FAM229 (also known as UPF0731) family of uncharacterised proteins is found in mammals. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0731