The domain within your query sequence starts at position 116 and ends at position 267; the E-value for the UPF1_Zn_bind domain shown below is 4.1e-78.

HACSYCGIHDPACVVYCNTSKKWFCNGRGNTSGSHIVNHLVRAKCKEVTLHKDGPLGETV
LECYNCGCRNVFLLGFIPAKADSVVVLLCRQPCASQSSLKDINWDSSQWQPLIQDRCFLS
WLVKIPSEQEQLRARQITAQQINKLEELWKEN

UPF1_Zn_bind

 UPF1_Zn_bind
PFAM accession number:PF09416
Interpro abstract (IPR018999):

UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation. This domain contains 3 zinc binding motifs and forms interactions with another protein (UPF2) that is also involved nonsense-mediated mRNA decay (NMD) [ (PUBMED:16931876) ].

GO process:nuclear-transcribed mRNA catabolic process, nonsense-mediated decay (GO:0000184)
GO component:cytoplasm (GO:0005737)
GO function:zinc ion binding (GO:0008270), ATP binding (GO:0005524), helicase activity (GO:0004386), DNA binding (GO:0003677)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF1_Zn_bind