The domain within your query sequence starts at position 460 and ends at position 608; the E-value for the USP7_C2 domain shown below is 2e-7.
PMQYKVIVPKIGNILDLCTALSALSGVPADKMIVTDIYNHRFHRIFAVDENLSSIMERDD IYVFEININRAEDTEHVVIPVCLREKFRHSSYTHHTGSSLFGQPFLMAIPRNNTEDKLYN LLLLRMCRYVKMSTETEETDGHLRCCEDQ
USP7_C2 |
---|
PFAM accession number: | PF14533 |
---|---|
Interpro abstract (IPR029346): | This domain is found in the C-terminal of the ubiquitin carboxyl-terminal hydrolases (USPs). Its function is not clear [ (PUBMED:14506283) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry USP7_C2