The domain within your query sequence starts at position 661 and ends at position 906; the E-value for the USP7_ICP0_bdg domain shown below is 7.1e-79.
IRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLETVDPELAASGATLPKF DKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCDRAGFIQDTSLILYEEVK PNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFC DKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQFFKSQGYRDGPGNPLRHNYEG TLRDLL
USP7_ICP0_bdg |
---|
PFAM accession number: | PF12436 |
---|---|
Interpro abstract (IPR024729): | This domain is found in proteins of the peptidase C19 family, which contains ubiquitinyl hydrolases like ubiquitin carboxyl-terminal hydrolase 7 (USP7) [ (PUBMED:14506283) ]. This domain is one of two C-terminal domains on the much longer ubiquitin-specific proteases. It is found to interact with the herpesvirus 1 trans-acting transcriptional protein ICP0/VMW110. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry USP7_ICP0_bdg