The domain within your query sequence starts at position 19 and ends at position 112; the E-value for the USP8_dimer domain shown below is 5.8e-18.

HTDVSLSPEERVRALSKLGCNISINEDITPRRYFRSGVEMERMASVYLEEGNLENAFVLY
NKFITLFVEKLPSHRDYQQCAVPEKQDIMKKLKE

USP8_dimer

USP8_dimer
PFAM accession number:PF08969
Interpro abstract (IPR015063):

This domain is found in the amino terminal region of Ubiquitin carboxyl-terminal hydrolase 8 (USP8). It forms a five helical bundle that dimerises [ (PUBMED:17035239) ]. It is also found in other proteins, including AMSH-like protease and STAM-binding protein.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry USP8_dimer