The domain within your query sequence starts at position 19 and ends at position 132; the E-value for the USP8_dimer domain shown below is 3.9e-21.
HTDVSLSPEERVRALSKLGCNISINEDITPRRYFRSGVEMERMASVYLEEGNLENAFVLY NKFITLFVEKLPSHRDYQQCAVPEKQDIMKKLKEIAFPRTDELKTDLLRKYNIE
USP8_dimer |
---|
PFAM accession number: | PF08969 |
---|---|
Interpro abstract (IPR015063): | This domain is found in the amino terminal region of Ubiquitin carboxyl-terminal hydrolase 8 (USP8). It forms a five helical bundle that dimerises [ (PUBMED:17035239) ]. It is also found in other proteins, including AMSH-like protease and STAM-binding protein. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry USP8_dimer