The domain within your query sequence starts at position 343 and ends at position 490; the E-value for the UTP15_C domain shown below is 3.5e-50.
NYLKQRDDIMVSRPAKKHLEGYDKDLKSFRVSQALDRVLEPKCVIRTPEVTVSIIKELTR RGVLANALAGRDEKEVTRVLNFLIRNLSQPRFAPVLINAAEIIIDIYLPVIGQSSVVDKK FIVLQELVEKEIDYQRELLETLGMMDML
UTP15_C |
![]() |
---|
PFAM accession number: | PF09384 |
---|---|
Interpro abstract (IPR018983): | This entry represents the C-terminal domain of the U3 small nucleolar RNA-associated protein 15 (UTP15). This protein is involved in nucleolar processing of pre-18S ribosomal RNA, and is required for optimal pre-ribosomal RNA transcription by RNA polymerase I together with a subset of U3 proteins required for transcription (t-UTPs). UTP15 is a component of the ribosomal small subunit (SSU) processome, which is a large ribonucleoprotein (RNP) required for processing of precursors to the small subunit RNA, the 18S, of the ribosome [ (PUBMED:15590835) (PUBMED:15489292) ]. This domain is found C-terminal to the WD40 repeat ( IPR001680 ). UTP15 associates with U3 snoRNA, which is ubiquitous in eukaryotes and is required for nucleolar processing of pre-18S ribosomal RNA [ (PUBMED:12068309) ]. |
GO process: | rRNA processing (GO:0006364) |
GO component: | nucleolus (GO:0005730) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UTP15_C