The domain within your query sequence starts at position 89 and ends at position 348; the E-value for the UbiA domain shown below is 2.1e-52.

LYLPCTWSIGLAADPGCFPDWYMLSLFGTGAILMRGAGCTINDMWDRDFDKKVTRTANRP
IAAGDISTFQSFVFLGGQLTLALGVLLCLNYYSIAMGAASLLLVVTYPLVKRITFWPQLA
LGLTFNWGALLGWSAVKGSCDPAVCLPLYFSGVMWTLIYDTIYAHQDKKDDALIGLKSTA
LLFQENTRQWLSGFGVAMVAALSLAGANNGQTVPYYAAVAAVGAHLAHQIYTVDIHRAED
CWDKFTSNRTVGMLLFLGIV

UbiA

UbiA
PFAM accession number:PF01040
Interpro abstract (IPR000537):

The UbiA family of prenyltransferases includes bacterial 4-hydroxybenzoate octaprenyltransferase (gene ubiA); yeast mitochondrial para-hydroxybenzoate--polyprenyltransferase (gene COQ2); protohaem IX farnesyltransferase (haem O synthase) from yeast and mammals (gene COX10), and from bacteria (genes cyoE or ctaB) [ (PUBMED:8155731) (PUBMED:7885224) ]; and 2-acylphloroglucinol 4-prenyltransferase and 2-acyl-4-prenylphloroglucinol 6-prenyltransferase from plant chloroplasts which catalyze prenylation steps in the beta-bitter acid pathway [ (PUBMED:22166201) (PUBMED:25564559) ]. These are integral membrane proteins, which probably contain seven transmembrane segments. Archaeal family members include lycopene elongase/hydratase - this type of enzyme has been shown to be involved in bacterioruberin synthesis in Halobacterium salinarum and Haloferax volcanii [ (PUBMED:21840984) ].

GO component:integral component of membrane (GO:0016021)
GO function:transferase activity, transferring alkyl or aryl (other than methyl) groups (GO:0016765)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UbiA