The domain within your query sequence starts at position 112 and ends at position 244; the E-value for the Ubie_methyltran domain shown below is 3.1e-7.

ALELLFDQLHEGAKALDVGSGSGILTACFARMVGNSGKVIGIDHIKELVDDSITNVKKDD
PMLLSSGRVRLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAG
GNQMLEQYDKLQD

Ubie_methyltran

Ubie_methyltran
PFAM accession number:PF01209
Interpro abstract (IPR004033):

This entry represents a family of methyltransferases involved in the biosynthesis of menaquinone and ubiqinone. Some members such as the UbiE enzyme from E. coli [ (PUBMED:9045837) ] are believed to act in both pathways, while others may act in only the menaquinone pathway. These methyltransferases are members of the UbiE/CoQ family of methyltransferases which also contains ubiquinone methyltransferases and other methyltransferases. Members of this clade include a wide distribution of bacteria and eukaryotes, but no archaea. An outgroup for this clade is provided by the phosphatidylethanolamine methyltransferase ( EC 2.1.1.17 ) from Rhodobacter sphaeroides [ (PUBMED:8340421) ]. Note that a number of non-orthologous genes which are members of IPR005493 have been erroneously annotated as MenG methyltransferases.

GO function:methyltransferase activity (GO:0008168)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ubie_methyltran