The domain within your query sequence starts at position 105 and ends at position 191; the E-value for the Ubiq_cyt_C_chap domain shown below is 8.1e-22.

SKWVNSYILKKNMALMTNNFYAAILGYDEGILSDDHGLAAALWRTFFNQKCEDPRQLELL
VEYVRKQMQYLDSMNGEDLLLTGEVRW

Ubiq_cyt_C_chap

Ubiq_cyt_C_chap
PFAM accession number:PF03981
Interpro abstract (IPR021150):

Saccharomyces cerevisiae ubiquinol-cytochrome C chaperone is required for assembly of coenzyme QF-2-cytochrome C reductase. It appears to be found in a number of different organisms including Homo sapiens, Caenorhabditis elegans and Rhizobium meliloti.

This entry also contains bacterial proteins belonging to the UPF0174 family.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ubiq_cyt_C_chap