The domain within your query sequence starts at position 188 and ends at position 245; the E-value for the Ubiq_cyt_C_chap domain shown below is 2.9e-14.
GILSDDHGLAAALWRTFFNQKCEDPRQLELLVEYVRKQMQYLDSMNGEDLLLTGEVRW
Ubiq_cyt_C_chap |
![]() |
---|
PFAM accession number: | PF03981 |
---|---|
Interpro abstract (IPR021150): | Saccharomyces cerevisiae ubiquinol-cytochrome C chaperone is required for assembly of coenzyme QF-2-cytochrome C reductase. It appears to be found in a number of different organisms including Homo sapiens, Caenorhabditis elegans and Rhizobium meliloti. This entry also contains bacterial proteins belonging to the UPF0174 family. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ubiq_cyt_C_chap